Macrod2 (NM_028387) Mouse Recombinant Protein

CAT#: TP500464

Purified recombinant protein of Mouse MACRO domain containing 2 (Macrod2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200464 protein sequence
Red=Cloning site Green=Tags(s)

MMDASLMVGEMVENVMGESTCRSLPETVMERKSYSLGNRKRGPLSDLVFQSILNQERLIEDSLRRVCFEE
EKQTKKGGRESELPEGKQTRRVGDTCSFVACLTNTDLPGVNIEN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 12.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082663
Locus ID 72899
UniProt ID Q9D117
Refseq Size 3552
Cytogenetics 2 F3-G1
Refseq ORF 345
Synonyms 1110033L15Rik; 2610107G07Rik; 2900006F19Rik
Summary Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety. Inactive towards proteins bearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...