Pclaf (NM_026515) Mouse Recombinant Protein

CAT#: TP500414

Purified recombinant protein of Mouse PCNA clamp associated factor (Pclaf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200414 protein sequence
Red=Cloning site Green=Tags(s)

MVRTKANYVPGAYRKAVASQAPRKVLGSSTFVTNSSSSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRL
SPKESKKENQAPEEAGTSGLGKAKRKACPLQPDHRDDENE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 12 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080791
Locus ID 68026
UniProt ID Q9CQX4
Refseq Size 2387
Cytogenetics 9 C
Refseq ORF 330
Synonyms 2810417H13Rik; AA409629; mKIAA0101; Ns5apt9; Ns5atp9; p15(PAF); Paf; PAF15
Summary PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...