Uqcrh (NM_025641) Mouse Recombinant Protein
CAT#: TP500223
Purified recombinant protein of Mouse ubiquinol-cytochrome c reductase hinge protein (Uqcrh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200223 protein sequence
Red=Cloning site Green=Tags(s) MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELF DFLHARDHCVAHKLFKNLK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079917 |
Locus ID | 66576 |
UniProt ID | P99028 |
Refseq Size | 562 |
Cytogenetics | 4 D1 |
Refseq ORF | 270 |
Synonyms | 2210416J04Rik; 2310021J10Rik; 2610041P16Rik |
Summary | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |