United States
Germany
Japan
United Kingdom
China
NIT1 (NM_001185093) Human Recombinant Protein
CAT＃: TP331154
Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg
View other "NIT1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC231154 representing NM_001185093
Red=Cloning site Green=Tags(s) MTFGLRKRLSEERGFSLMPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLP EAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGAV VATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPELSLALAQAGAEILTY PSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLAR IDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.8 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001172022 |
| Locus ID | 4817 |
| UniProt ID | Q86X76 |
| Cytogenetics | 1q23.3 |
| Refseq ORF | 936 |
| Summary | This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401717 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433784 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434153 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401717 | Transient overexpression lysate of nitrilase 1 (NIT1) |
CNY 3,080.00 |
|
| LY433784 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 |
CNY 3,080.00 |
|
| LY434153 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 |
CNY 3,080.00 |
|
| PH311519 | NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591) |
CNY 19,520.00 |
|
| TP311519 | Recombinant protein of human nitrilase 1 (NIT1), 20 µg |
CNY 2,900.00 |
