NIT1 (NM_005600) Human Mass Spec Standard
CAT#: PH311519
NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591)
View other "NIT1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211519 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC211519 representing NM_005600
Red=Cloning site Green=Tags(s) MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005591 |
RefSeq Size | 1385 |
RefSeq ORF | 981 |
Locus ID | 4817 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401717 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433784 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434153 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401717 | Transient overexpression lysate of nitrilase 1 (NIT1) |
CNY 3,080.00 |
|
LY433784 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 |
CNY 3,080.00 |
|
LY434153 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 |
CNY 3,080.00 |
|
TP311519 | Recombinant protein of human nitrilase 1 (NIT1), 20 µg |
CNY 2,900.00 |
|
TP331154 | Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg |
CNY 2,900.00 |