C8orf58 (NM_001198827) Human Recombinant Protein
CAT#: TP331145
Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), transcript variant 3, 20 µg
View other "C8orf58" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231145 representing NM_001198827
Red=Cloning site Green=Tags(s) MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSG VEMAVGDSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLERSRRLPTAPTSLSGQHRSLRL ASKPEREVPLGAGQQESMEADTDLEAGLEEEAVGGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYL QLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPV EPTYHLPSSQGHKDRVQGPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001185756 |
Locus ID | 541565 |
UniProt ID | A0A087WX44 |
Cytogenetics | 8p21.3 |
Refseq ORF | 900 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423043 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434144 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434181 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY423043 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58) |
CN¥ 3,080.00 |
|
LY434144 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 3 |
CN¥ 3,080.00 |
|
LY434181 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 2 |
CN¥ 3,080.00 |
|
PH318522 | C8orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001013864) |
CN¥ 14,250.00 |
|
TP318522 | Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), 20 µg |
CN¥ 2,900.00 |
其它C8orf58产品