CD1E (NM_001185115) Human Recombinant Protein
CAT#: TP331127
Recombinant protein of human CD1e molecule (CD1E), transcript variant 8, 20 µg
View other "CD1E" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231127 representing NM_001185115
Red=Cloning site Green=Tags(s) MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTV LGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLELKPEAWLSCGPSPGPGRLQLVC HVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIH WGGYSIFLILICLTVIVTLVILVVVDSRLKKQSPVFLMGANTQDTKNSRHQFCLAQVSWIKNRVLKKWKT RLNQLW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.7 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001172044 |
Locus ID | 913 |
UniProt ID | P15812 |
Cytogenetics | 1q23.1 |
Refseq ORF | 858 |
Synonyms | CD1A; R2 |
Summary | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403088 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC420991 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC420992 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC420993 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434131 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434141 | CD1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403088 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 1 |
CN¥ 3,080.00 |
|
LY420991 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 2 |
CN¥ 3,080.00 |
|
LY420992 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 3 |
CN¥ 3,080.00 |
|
LY420993 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 4 |
CN¥ 3,080.00 |
|
LY434131 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 13 |
CN¥ 3,080.00 |
|
LY434141 | Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 7 |
CN¥ 3,080.00 |