YJEFN3 (NM_001190328) Human Recombinant Protein
CAT#: TP331097
Recombinant protein of human YjeF N-terminal domain containing 3 (YJEFN3), transcript variant 2, 20 µg
View other "YJEFN3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231097 representing NM_001190328
Red=Cloning site Green=Tags(s) MSSAAGPDPSEAPEERHFLSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTV LVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYG LVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCA GRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001177257 |
Locus ID | 374887 |
UniProt ID | A6XGL0 |
Cytogenetics | 19p13.11 |
Refseq ORF | 747 |
Summary | May play a role in spermiogenesis and oogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404841 | YJEFN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434096 | YJEFN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404841 | Transient overexpression lysate of YjeF N-terminal domain containing 3 (YJEFN3), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
LY434096 | Transient overexpression lysate of YjeF N-terminal domain containing 3 (YJEFN3), transcript variant 2 |
CNY 3,080.00 |