ATXN10 (NM_001167621) Human Recombinant Protein
CAT#: TP330029
Recombinant protein of human ataxin 10 (ATXN10), transcript variant 2, 20 µg
View other "ATXN10" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC230029 representing NM_001167621
Red=Cloning site Green=Tags(s) MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRNLDTIGVAVDLILLFRELRVEQESLLTAFRC GLQFLGNIASRNEDSQSIVWVHAFPELFLSCLNHPDKKIVAYSSMILFTSLNHERMKELEENLNIAIDVI DAYQKHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAEL IASTFVDQCKTVLKLASEEPPDDEEALATIRLLDVLCEMTVNTELLGYLQVFPGLLERVIDLLRVIHVAG KETTNIFSNCGCVRAEGDISNVANGFKSHLIRLIGNLCYKNKDNQDKVNELDGIPLILDNCNISDSNPFL TQWVIYAIRNLTEDNSQNQDLIAKMEEQGLADASLLKKVGFEVEKKGEKLILKSTRDTPKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.7 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001161093 |
Locus ID | 25814 |
UniProt ID | Q9UBB4 |
Cytogenetics | 22q13.31 |
Refseq ORF | 1233 |
Synonyms | E46L; HUMEEP; SCA10 |
Summary | This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415723 | ATXN10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433029 | ATXN10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415723 | Transient overexpression lysate of ataxin 10 (ATXN10), transcript variant 1 |
CNY 3,080.00 |
|
LY433029 | Transient overexpression lysate of ataxin 10 (ATXN10), transcript variant 2 |
CNY 3,080.00 |
|
PH301300 | ATXN10 MS Standard C13 and N15-labeled recombinant protein (NP_037368) |
CNY 14,250.00 |
|
TP301300 | Recombinant protein of human ataxin 10 (ATXN10), 20 µg |
CNY 2,900.00 |