PP11 (ENDOU) (NM_001172440) Human Recombinant Protein
CAT#: TP329923
Purified recombinant protein of Homo sapiens endonuclease, polyU-specific (ENDOU), transcript variant 3, 20 µg
View other "PP11" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229923 representing NM_001172440
Red=Cloning site Green=Tags(s) MRACISLVLAVLCGLAWADLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSS DAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFI NLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSR GNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYK EVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.1 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001165911 |
Locus ID | 8909 |
UniProt ID | P21128 |
Cytogenetics | 12q13.11 |
Refseq ORF | 1041 |
Synonyms | P11; PP11; PRSS26 |
Summary | This gene encodes a protein with endoribonuclease activity that binds polyuridine-enriched single-stranded RNA. This gene was initially characterized based on its high expression in placenta but was mischaracterized as a serine protease. In mouse, this gene promotes tolerance to self-antigens by regulating B cell activation-induced cell death (AICD). The protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2020] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC432923 | ENDOU HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC433028 | ENDOU HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY432923 | Transient overexpression lysate of endonuclease, polyU-specific (ENDOU), transcript variant 3 |
CN¥ 3,080.00 |
|
LY433028 | Transient overexpression lysate of endonuclease, polyU-specific (ENDOU), transcript variant 1 |
CN¥ 3,080.00 |