LY108 (SLAMF6) (NM_001184715) Human Recombinant Protein
CAT#: TP329827
Purified recombinant protein of Homo sapiens SLAM family member 6 (SLAMF6), transcript variant 3, 20 µg
View other "LY108" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229827 representing NM_001184715
Red=Cloning site Green=Tags(s) MLWLFQSLLFVFCFGPVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKL SSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISS EQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLST QRTQGPESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDN VV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171644 |
Locus ID | 114836 |
UniProt ID | Q96DU3, B4E1U5 |
Cytogenetics | 1q23.2-q23.3 |
Refseq ORF | 846 |
Synonyms | CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000 |
Summary | The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409387 | SLAMF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432715 | SLAMF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432827 | SLAMF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409387 | Transient overexpression lysate of SLAM family member 6 (SLAMF6) |
CNY 3,080.00 |
|
LY432715 | Transient overexpression lysate of SLAM family member 6 (SLAMF6), transcript variant 4 |
CNY 3,080.00 |
|
LY432827 | Transient overexpression lysate of SLAM family member 6 (SLAMF6), transcript variant 3 |
CNY 3,080.00 |
|
TP720652 | Purified recombinant protein of Human SLAM family member 6 (SLAMF6), transcript variant 2 |
CNY 3,140.00 |
|
TP723971 | Human NTB-A Protein, mFc-His Tag |
CNY 4,925.00 |