CD99L2 (NM_001184808) Human Recombinant Protein
CAT#: TP329656M
Purified recombinant protein of Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 4, 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229656 representing NM_001184808
Red=Cloning site Green=Tags(s) MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSG LDLADALDDQDDGRRKPGIGGRGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKF CFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171737 |
Locus ID | 83692 |
UniProt ID | Q8TCZ2 |
Cytogenetics | Xq28 |
Refseq ORF | 567 |
Synonyms | CD99B; MIC2L1 |
Summary | This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |