CD99L2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CD99L2 antibody: synthetic peptide directed towards the middle region of human CD99L2. Synthetic peptide located within the following region: RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	CD99 molecule like 2
Database Link	NP_604395 Entrez Gene 83692 Human UniProt ID Q8TCZ2
Background	The function remains unknown.
Synonyms	CD99B; MIC2L1
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 92%; Guinea pig: 91%; Mouse: 86%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.