PECI (ECI2) (NM_001166010) Human Recombinant Protein
CAT#: TP328846
Recombinant protein of human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, 20 µg
View other "PECI" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228846 protein sequence
Red=Cloning site Green=Tags(s) MNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALG SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIA VVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGE ACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDEC TNAVVNFLSRKSKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001159482 |
Locus ID | 10455 |
UniProt ID | O75521 |
Refseq Size | 1422 |
Cytogenetics | 6p25.2 |
Refseq ORF | 1092 |
Synonyms | ACBD2; dJ1013A10.3; DRS-1; DRS1; HCA88; PECI |
Summary | This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011] |
Protein Pathways | Fatty acid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401844 | ECI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431874 | ECI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401844 | Transient overexpression lysate of peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1 |
CNY 3,080.00 |
|
LY431874 | Transient overexpression lysate of enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3 |
CNY 3,080.00 |
|
PH304994 | PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108) |
CNY 19,520.00 |
|
TP304994 | Recombinant protein of human peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1, 20 µg |
CNY 2,900.00 |