SHOX2 (NM_001163678) Human Recombinant Protein
CAT#: TP328253
Recombinant protein of human short stature homeobox 2 (SHOX2), transcript variant 3, 20 µg
View other "SHOX2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228253 representing NM_001163678
Red=Cloning site Green=Tags(s) MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAGGGGGGGGGGG GGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQ RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGA ASQFEACRVAPYVNVGALRMPFQQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLATLAAD SASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001157150 |
Locus ID | 6474 |
UniProt ID | O60902 |
Cytogenetics | 3q25.32 |
Refseq ORF | 957 |
Synonyms | OG12; OG12X; SHOT |
Summary | This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416363 | SHOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431281 | SHOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416363 | Transient overexpression lysate of short stature homeobox 2 (SHOX2), transcript variant 2 |
CNY 3,080.00 |
|
LY431281 | Transient overexpression lysate of short stature homeobox 2 (SHOX2), transcript variant 3 |
CNY 3,080.00 |
|
TP760471 | Purified recombinant protein of Human short stature homeobox 2 (SHOX2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |