SHOX2 Rabbit Polyclonal Antibody
CAT#: TA333910
Rabbit Polyclonal Anti-SHOX2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SHOX2 Antibody: synthetic peptide directed towards the middle region of human SHOX2. Synthetic peptide located within the following region: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | short stature homeobox 2 |
Database Link | |
Background | SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. |
Synonyms | OG12; OG12X; SHOT |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Precocious chondrocyte differentiation disrupts skeletal growth in Kabuki syndrome mice
,Fahrner, JA;Lin, WY;Riddle, RC;Boukas, L;DeLeon, VB;Chopra, S;Lad, SE;Luperchio, TR;Hansen, KD;Bjornsson, HT;,
JCI Insight
,PubMed ID 31557133
[SHOX2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |