SFTPA1 (NM_001164646) Human Recombinant Protein
CAT#: TP328130
Purified recombinant protein of Homo sapiens surfactant protein A1 (SFTPA1), transcript variant 6, 20 µg
View other "SFTPA1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228130 representing NM_001164646
Red=Cloning site Green=Tags(s) MWLCPLALNLILMAASGAVCEVKDVCVGTPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQIL QTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGL TEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001158118 |
Locus ID | 653509 |
UniProt ID | Q8IWL2 |
Cytogenetics | 10q22.3 |
Refseq ORF | 597 |
Synonyms | COLEC4; PSAP; PSP-A; PSPA; SFTP1; SFTPA1B; SP-A; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA; SPA1 |
Summary | This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417309 | SFTPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431158 | SFTPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431809 | SFTPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431810 | SFTPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417309 | Transient overexpression lysate of surfactant protein A1 (SFTPA1), transcript variant 1 |
CNY 3,080.00 |
|
LY431158 | Transient overexpression lysate of surfactant protein A1 (SFTPA1), transcript variant 6 |
CNY 3,080.00 |
|
LY431809 | Transient overexpression lysate of surfactant protein A1 (SFTPA1), transcript variant 3 |
CNY 3,080.00 |
|
LY431810 | Transient overexpression lysate of surfactant protein A1 (SFTPA1), transcript variant 4 |
CNY 3,080.00 |
|
TP328781 | Recombinant protein of human surfactant protein A1 (SFTPA1), transcript variant 3, 20 µg |
CNY 2,900.00 |