United States
Germany
Japan
United Kingdom
China
GKAP1 (NM_001135953) Human Recombinant Protein
CAT＃: TP327915
Purified recombinant protein of Homo sapiens G kinase anchoring protein 1 (GKAP1), transcript variant 2, 20 µg
View other "GKAP1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227915 representing NM_001135953
Red=Cloning site Green=Tags(s) MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEEVVLKDGRIERLKLE LERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHA ALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129425 |
| Locus ID | 80318 |
| UniProt ID | Q5VSY0 |
| Cytogenetics | 9q21.32 |
| Refseq ORF | 945 |
| Synonyms | FKSG21; GKAP42 |
| Summary | This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410835 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427741 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410835 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 |
CNY 3,080.00 |
|
| LY427741 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 2 |
CNY 3,080.00 |
|
| PH304911 | GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487) |
CNY 19,520.00 |
|
| PH327915 | GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425) |
CNY 14,250.00 |
|
| TP304911 | Recombinant protein of human G kinase anchoring protein 1 (GKAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP761516 | Purified recombinant protein of Human G kinase anchoring protein 1 (GKAP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
