United States
Germany
Japan
United Kingdom
China
GKAP1 (NM_025211) Human Mass Spec Standard
CAT＃: PH304911
GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487)
View other "GKAP1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204911 |
| Predicted MW | 42.1 kDa |
| Protein Sequence |
>RC204911 protein sequence
Red=Cloning site Green=Tags(s) MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFF NRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWE AKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKY QGGRKGKRNSESDQCR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079487 |
| RefSeq Size | 1891 |
| RefSeq ORF | 1098 |
| Synonyms | FKSG21; GKAP42 |
| Locus ID | 80318 |
| Cytogenetics | 9q21.32 |
| Summary | This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410835 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427741 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410835 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 |
CNY 3,080.00 |
|
| LY427741 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 2 |
CNY 3,080.00 |
|
| PH327915 | GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425) |
CNY 14,250.00 |
|
| TP304911 | Recombinant protein of human G kinase anchoring protein 1 (GKAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327915 | Purified recombinant protein of Homo sapiens G kinase anchoring protein 1 (GKAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761516 | Purified recombinant protein of Human G kinase anchoring protein 1 (GKAP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
