RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein
CAT#: TP327715
Recombinant protein of human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4, 20 µg
View other "RIZ1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227715 representing NM_001135610
Red=Cloning site Green=Tags(s) MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY NGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKS RHSGCSLTAPEVTWNQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129082 |
Locus ID | 7799 |
UniProt ID | Q13029 |
Cytogenetics | 1p36.21 |
Refseq ORF | 678 |
Synonyms | HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2 |
Summary | This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427635 | PRDM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY427635 | Transient overexpression lysate of PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4 |
CN¥ 3,080.00 |
|
PH327715 | PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) |
CN¥ 19,520.00 |