United States
Germany
Japan
United Kingdom
China
Synaptotagmin 1 (SYT1) (NM_001135806) Human Recombinant Protein
CAT＃: TP327252
Recombinant protein of human synaptotagmin I (SYT1), transcript variant 3, 20 µg
View other "Synaptotagmin 1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 3,280.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227252 representing NM_001135806
Red=Cloning site Green=Tags(s) MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV KK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | MS digestion standard (PMID: 27716408) |
| Reference Data | |
| RefSeq | NP_001129278 |
| Locus ID | 6857 |
| UniProt ID | P21579 |
| Cytogenetics | 12q21.2 |
| Refseq ORF | 1266 |
| Synonyms | BAGOS; P65; SVP65; SYT |
| Summary | The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010] |
| Protein Families | Secreted Protein, Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The pre-synaptic vesicle protein synaptotagmin is a novel biomarker for Alzheimer's disease
,Öhrfelt, A;Brinkmalm, A;Dumurgier, J;Brinkmalm, G;Hansson, O;Zetterberg, H;Bouaziz-Amar, E;Hugon, J;Paquet, C;Blennow, K;,
Alzheimers Res Ther
,PubMed ID 27716408
[SYT1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417170 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427710 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427711 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417170 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 1 |
CNY 3,080.00 |
|
| LY427710 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 2 |
CNY 3,080.00 |
|
| LY427711 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 3 |
CNY 3,080.00 |
|
| PH308938 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_005630) |
CNY 14,250.00 |
|
| PH327105 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129277) |
CNY 19,520.00 |
|
| PH327252 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129278) |
CNY 19,520.00 |
|
| TP308938 | Purified recombinant protein of Homo sapiens synaptotagmin I (SYT1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327105 | Recombinant protein of human synaptotagmin I (SYT1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Synaptotagmin 1产品
