NEK6 (NM_001145001) Human Recombinant Protein
CAT#: TP327083
Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1, 20 µg
View other "NEK6" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227083 representing NM_001145001
Red=Cloning site Green=Tags(s) MPRREVCWEAAHFRQEEQSLPRPRVRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTL SFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNII KYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPA NVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSP FYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138473 |
Locus ID | 10783 |
UniProt ID | Q9HC98 |
Cytogenetics | 9q33.3 |
Refseq ORF | 1041 |
Synonyms | SID6-1512 |
Summary | The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402327 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428635 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431292 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431305 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431846 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431847 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402327 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2 |
CNY 3,080.00 |
|
LY428635 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1 |
CNY 3,080.00 |
|
LY431292 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 3 |
CNY 3,080.00 |
|
LY431305 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 7 |
CNY 3,080.00 |
|
LY431846 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5 |
CNY 3,080.00 |
|
LY431847 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 6 |
CNY 3,080.00 |
|
PH303609 | NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_055212) |
CNY 19,520.00 |
|
PH327083 | NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138473) |
CNY 19,520.00 |
|
TP303609 | Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP328818 | Purified recombinant protein of Homo sapiens NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5, 20 µg |
CNY 2,900.00 |