NCR1 (NM_001145458) Human Recombinant Protein
CAT#: TP326814
Purified recombinant protein of Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 20 µg
View other "NCR1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226814 representing NM_001145458
Red=Cloning site Green=Tags(s) MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV TGDIENTSLAPEDPTFPDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRR RLNTQTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138930 |
Locus ID | 9437 |
UniProt ID | O76036, A0A0A0MR94 |
Cytogenetics | 19q13.42 |
Refseq ORF | 861 |
Synonyms | CD335; LY94; NK-p46; NKP46 |
Summary | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417717 | NCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428900 | NCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417717 | Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1 |
CNY 3,080.00 |
|
LY428900 | Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2 |
CNY 3,080.00 |
|
PH326814 | NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930) |
CNY 14,250.00 |