PKR (EIF2AK2) (NM_001135651) Human Recombinant Protein
CAT#: TP326606
Purified recombinant protein of Homo sapiens eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226606 protein sequence
Red=Cloning site Green=Tags(s) MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKL AVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQK EYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSA DTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQ VFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPEN SKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFE TSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129123 |
Locus ID | 5610 |
UniProt ID | P19525 |
Refseq Size | 4127 |
Cytogenetics | 2p22.2 |
Refseq ORF | 1653 |
Synonyms | EIF2AK1; LEUDEN; PKR; PPP1R83; PRKR |
Summary | The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400976 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427650 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427651 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400976 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 1 |
CNY 3,080.00 |
|
LY427650 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2 |
CNY 3,080.00 |
|
LY427651 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 3 |
CNY 3,080.00 |
|
PH326606 | EIF2AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001129123) |
CNY 14,250.00 |
|
TP761991 | Purified recombinant protein of Human eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2,Glu51-Asn191, with N-terminal His-ABP tag, expressed in E. coli, 50ug |
CNY 2,050.00 |