United States
Germany
Japan
United Kingdom
China
ABH2 (ALKBH2) (NM_001145374) Human Recombinant Protein
CAT＃: TP326507
Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg
View other "ABH2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226507 protein sequence
Red=Cloning site Green=Tags(s) MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138846 |
| Locus ID | 121642 |
| UniProt ID | Q6NS38 |
| Refseq Size | 1206 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 783 |
| Synonyms | ABH2 |
| Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400362 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428853 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428854 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400362 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
CNY 3,080.00 |
|
| LY428853 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
CNY 3,080.00 |
|
| LY428854 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
CNY 3,080.00 |
|
| PH310103 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) |
CNY 19,520.00 |
|
| PH326507 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) |
CNY 19,520.00 |
|
| PH326527 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847) |
CNY 19,520.00 |
|
| TP310103 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326527 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg |
CNY 2,900.00 |
