ARHGEF7 (NM_001113513) Human Recombinant Protein
CAT#: TP326057
Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5, 20 µg
View other "ARHGEF7" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226057 representing NM_001113513
Red=Cloning site Green=Tags(s) MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPV SPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGN LEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMET KGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELE LQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPT TGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP SHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALC YKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKES APQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVR KVLKNMNDPAWDETNL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 73 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001106985 |
Locus ID | 8874 |
UniProt ID | Q14155, A0A024RDY9 |
Cytogenetics | 13q34 |
Refseq ORF | 1938 |
Synonyms | BETA-PIX; COOL-1; COOL1; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK3; PIXB |
Summary | This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Mar 2016] |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407867 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418366 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426426 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407867 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2 |
CNY 4,840.00 |
|
LY418366 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 1 |
CNY 4,840.00 |
|
LY426426 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5 |
CNY 3,080.00 |
|
PH318798 | ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_663788) |
CNY 19,520.00 |
|
PH326057 | ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_001106985) |
CNY 19,520.00 |
|
TP318798 | Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它ARHGEF7产品