RACGAP1 (NM_001126104) Human Recombinant Protein
CAT#: TP326046
Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg
View other "RACGAP1" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226046 protein sequence
Red=Cloning site Green=Tags(s) MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM LK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001119576 |
Locus ID | 29127 |
UniProt ID | Q9H0H5 |
Refseq Size | 3206 |
Cytogenetics | 12q13.12 |
Refseq ORF | 1896 |
Synonyms | CYK4; HsCYK-4; ID-GAP; MgcRacGAP |
Summary | This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402238 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426645 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426646 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402238 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426645 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426646 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 |
CN¥ 3,080.00 |
|
PH307542 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409) |
CN¥ 19,520.00 |
|
PH326045 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) |
CN¥ 14,250.00 |
|
PH326046 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) |
CN¥ 19,520.00 |
|
TP307542 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP326045 | Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它RACGAP1产品