Nuclear Factor 1 (NFIA) (NM_001134673) Human Recombinant Protein
CAT#: TP325878
Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 1, 20 µg
View other "Nuclear Factor 1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225878 representing NM_001134673
Red=Cloning site Green=Tags(s) MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVG PRDPSFVNIPQQTQSWYLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001128145 |
Locus ID | 4774 |
UniProt ID | Q12857 |
Cytogenetics | 1p31.3 |
Refseq ORF | 1527 |
Synonyms | BRMUTD; CTF; NF-I/A; NF1-A; NFI-A; NFI-L |
Summary | This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417202 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427477 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428916 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417202 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 2 |
CNY 3,080.00 |
|
LY427477 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 1 |
CNY 3,080.00 |
|
LY428916 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 3 |
CNY 3,080.00 |
|
PH304650 | NFIA MS Standard C13 and N15-labeled recombinant protein (NP_005586) |
CNY 19,520.00 |
|
PH325878 | NFIA MS Standard C13 and N15-labeled recombinant protein (NP_001128145) |
CNY 14,250.00 |
|
TP304650 | Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Nuclear Factor 1产品