YAP1 (NM_001130145) Human Recombinant Protein
CAT#: TP325864
Purified recombinant protein of Homo sapiens Yes-associated protein 1, 65kDa (YAP1), transcript variant 1, 20 µg
View other "YAP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225864 representing NM_001130145
Red=Cloning site Green=Tags(s) MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL AATKLDKESFLTWL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123617 |
Locus ID | 10413 |
UniProt ID | P46937 |
Cytogenetics | 11q22.1 |
Refseq ORF | 1512 |
Synonyms | COB1; YAP; YAP2; YAP65; YKI |
Summary | This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Calmodulin activates the Hippo signaling pathway by promoting LATS1 kinase–mediated inhibitory phosphorylation of the transcriptional coactivator YAP
,null,
The Journal of Biological Chemistry
,PubMed ID 35307353
[YAP1]
|
Yorkie Growth-Promoting Activity Is Limited by Atg1-Mediated Phosphorylation
,Tyra, LK;Nandi, N;Tracy, C;Krämer, H;,
Dev. Cell
,PubMed ID 32032548
[YAP1]
|
Protein painting, an optimized MS-based technique, reveals functionally relevant interfaces of the PD-1/PD-L1 complex and the YAP2/ZO-1 complex
,Haymond, A;Dey, D;Carter, R;Dailing, A;Nara, V;Nara, P;Venkatayogi, S;Paige, M;Liotta, L;Luchini, A;,
J. Biol. Chem.
,PubMed ID 31167787
[YAP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401842 | YAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC434268 | YAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401842 | Transient overexpression lysate of Yes-associated protein 1, 65kDa (YAP1), transcript variant 2 |
CNY 4,840.00 |
|
LY434268 | Transient overexpression lysate of Yes-associated protein 1 (YAP1), transcript variant 3 |
CNY 3,080.00 |
|
PH325864 | YAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123617) |
CNY 14,250.00 |