alpha 1 Antitrypsin (SERPINA1) (NM_001127706) Human Recombinant Protein
CAT#: TP325663
Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10, 20 µg
View other "alpha 1 Antitrypsin" proteins (41)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225663 protein sequence
Red=Cloning site Green=Tags(s) MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121178 |
Locus ID | 5265 |
UniProt ID | P01009 |
Refseq Size | 3303 |
Cytogenetics | 14q32.13 |
Refseq ORF | 1254 |
Synonyms | A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275 |
Summary | The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400112 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424179 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426858 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426859 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426860 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426861 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426862 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426863 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426864 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426865 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400112 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 |
CNY 3,080.00 |
|
LY424179 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
CNY 4,840.00 |
|
LY426858 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
CNY 3,080.00 |
|
LY426859 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
CNY 3,080.00 |
|
LY426860 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
CNY 3,080.00 |
|
LY426861 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
CNY 3,080.00 |
|
LY426862 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
CNY 3,080.00 |
|
LY426863 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
CNY 3,080.00 |
|
LY426864 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
CNY 3,080.00 |
|
LY426865 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
CNY 3,080.00 |
|
PH302082 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286) |
CNY 19,520.00 |
|
PH321489 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001002236) |
CNY 19,520.00 |
|
PH325656 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121173) |
CNY 14,250.00 |
|
PH325657 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121174) |
CNY 14,250.00 |
|
PH325658 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121175) |
CNY 14,250.00 |
|
PH325659 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121176) |
CNY 14,250.00 |
|
PH325661 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121177) |
CNY 14,250.00 |
|
PH325663 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121178) |
CNY 14,250.00 |
|
PH325664 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121179) |
CNY 14,250.00 |
|
PH325668 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) |
CNY 14,250.00 |
|
TP302082 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321489 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325656 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP325657 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP325658 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP325659 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
TP325661 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9, 20 µg |
CNY 2,900.00 |
|
TP325664 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11, 20 µg |
CNY 2,900.00 |
|
TP325668 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP701025 | Purified protein of human z-type alpha-1-antitrypsin protein Glu342Lys mutant, Tag Free, secretory expressed in HEK cells, 50ug |
CNY 6,650.00 |
|
TP760123 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它alpha 1 Antitrypsin产品