NAPE PLD (NAPEPLD) (NM_001122838) Human Recombinant Protein
CAT#: TP325603
Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1, 20 µg
View other "NAPE PLD" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225603 representing NM_001122838
Red=Cloning site Green=Tags(s) MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116310 |
Locus ID | 222236 |
UniProt ID | Q6IQ20 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1179 |
Synonyms | C7orf18; FMP30; NAPE-PLD |
Summary | NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404703 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426574 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404703 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2 |
CNY 3,080.00 |
|
LY426574 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1 |
CNY 3,080.00 |
|
PH309877 | NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_945341) |
CNY 19,520.00 |
|
PH325603 | NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_001116310) |
CNY 19,520.00 |
|
TP309877 | Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它NAPE PLD产品