Heme oxygenase 2 (HMOX2) (NM_001127205) Human Recombinant Protein
CAT#: TP325452
Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 20 µg
View other "Heme oxygenase 2" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225452 representing NM_001127205
Red=Cloning site Green=Tags(s) MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120677 |
Locus ID | 3163 |
UniProt ID | P30519 |
Refseq Size | 1776 |
Cytogenetics | 16p13.3 |
Refseq ORF | 948 |
Synonyms | HO-2 |
Summary | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013] |
Protein Families | Transmembrane |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419512 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426707 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426708 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426709 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419512 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 3 |
CN¥ 3,080.00 |
|
LY426707 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426708 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426709 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 4 |
CN¥ 3,080.00 |
|
PH301777 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125) |
CN¥ 19,520.00 |
|
PH325452 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677) |
CN¥ 14,250.00 |
|
PH325453 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120678) |
CN¥ 14,250.00 |
|
TP301777 | Recombinant protein of human heme oxygenase (decycling) 2 (HMOX2), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP325453 | Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
其它Heme oxygenase 2产品