SETBP1 (NM_001130110) Human Recombinant Protein
CAT#: TP325305
Recombinant protein of human SET binding protein 1 (SETBP1), transcript variant 2, 20 µg
View other "SETBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225305 representing NM_001130110
Red=Cloning site Green=Tags(s) MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVD SNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQK VSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERA MCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123582 |
Locus ID | 26040 |
UniProt ID | Q9Y6X0 |
Cytogenetics | 18q12.3 |
Refseq ORF | 726 |
Synonyms | MRD29; SEB |
Summary | This gene encodes a protein which contains a several motifs including a ski homology region and a SET-binding region in addition to three nuclear localization signals. The encoded protein has been shown to bind the SET nuclear oncogene which is involved in DNA replication. Mutations in this gene are associated with Schinzel-Giedion midface retraction syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427169 | SETBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427169 | Transient overexpression lysate of SET binding protein 1 (SETBP1), transcript variant 2 |
CNY 3,080.00 |
|
PH325305 | SETBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123582) |
CNY 14,250.00 |