SETBP1 (NM_001130110) Human Mass Spec Standard
CAT#: PH325305
SETBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123582)
View other "SETBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | SETBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123582) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225305 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC225305 representing NM_001130110
Red=Cloning site Green=Tags(s) MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVD SNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQK VSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERA MCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001123582 |
RefSeq ORF | 726 |
Synonyms | MRD29; SEB |
Locus ID | 26040 |
Cytogenetics | 18q12.3 |
Summary | This gene encodes a protein which contains a several motifs including a ski homology region and a SET-binding region in addition to three nuclear localization signals. The encoded protein has been shown to bind the SET nuclear oncogene which is involved in DNA replication. Mutations in this gene are associated with Schinzel-Giedion midface retraction syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427169 | SETBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427169 | Transient overexpression lysate of SET binding protein 1 (SETBP1), transcript variant 2 |
CNY 3,080.00 |
|
TP325305 | Recombinant protein of human SET binding protein 1 (SETBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |