Vgl4 (VGLL4) (NM_001128221) Human Recombinant Protein
CAT#: TP325235
Purified recombinant protein of Homo sapiens vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 20 µg
View other "Vgl4" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225235 representing NM_001128221
Red=Cloning site Green=Tags(s) MNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTP GERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEP EPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121693 |
Locus ID | 9686 |
UniProt ID | Q14135 |
Cytogenetics | 3p25.3-p25.2 |
Refseq ORF | 618 |
Synonyms | VGL-4 |
Summary | May act as a specific coactivator for the mammalian TEFs.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415121 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426931 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426933 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415121 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2 |
CNY 3,080.00 |
|
LY426931 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1 |
CNY 3,080.00 |
|
LY426933 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4 |
CNY 3,080.00 |
|
PH300886 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482) |
CNY 19,520.00 |
|
PH325235 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693) |
CNY 14,250.00 |
|
PH325405 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691) |
CNY 19,520.00 |
|
TP300886 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325405 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 20 µg |
CNY 2,900.00 |