United States
Germany
Japan
United Kingdom
China
Vgl4 (VGLL4) (NM_001128221) Human Recombinant Protein
CAT＃: TP325235
Purified recombinant protein of Homo sapiens vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 20 µg
View other "Vgl4" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225235 representing NM_001128221
Red=Cloning site Green=Tags(s) MNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTP GERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEP EPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001121693 |
| Locus ID | 9686 |
| UniProt ID | Q14135 |
| Cytogenetics | 3p25.3-p25.2 |
| Refseq ORF | 618 |
| Synonyms | VGL-4 |
| Summary | May act as a specific coactivator for the mammalian TEFs.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415121 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426931 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426933 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415121 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2 |
CNY 3,080.00 |
|
| LY426931 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1 |
CNY 3,080.00 |
|
| LY426933 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4 |
CNY 3,080.00 |
|
| PH300886 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482) |
CNY 19,520.00 |
|
| PH325235 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693) |
CNY 14,250.00 |
|
| PH325405 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691) |
CNY 19,520.00 |
|
| TP300886 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325405 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 20 µg |
CNY 2,900.00 |
