Vgl4 (VGLL4) (NM_014667) Human Mass Spec Standard
CAT#: PH300886
VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482)
View other "Vgl4" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200886 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC200886 protein sequence
Red=Cloning site Green=Tags(s) METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCD NDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSL DASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVE EHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMV SHSHSPSVVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055482 |
RefSeq Size | 3756 |
RefSeq ORF | 870 |
Synonyms | VGL-4 |
Locus ID | 9686 |
Cytogenetics | 3p25.3-p25.2 |
Summary | May act as a specific coactivator for the mammalian TEFs.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415121 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426931 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426933 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415121 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2 |
CNY 3,080.00 |
|
LY426931 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1 |
CNY 3,080.00 |
|
LY426933 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4 |
CNY 3,080.00 |
|
PH325235 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693) |
CNY 14,250.00 |
|
PH325405 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691) |
CNY 19,520.00 |
|
TP300886 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325235 | Purified recombinant protein of Homo sapiens vestigial like 4 (Drosophila) (VGLL4), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP325405 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1, 20 µg |
CNY 2,900.00 |