ING4 (NM_001127586) Human Recombinant Protein
CAT#: TP325191
Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg
View other "ING4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225191 representing NM_001127586
Red=Cloning site Green=Tags(s) MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTVPLSGSILPVWG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121058 |
Locus ID | 51147 |
UniProt ID | Q9UNL4 |
Cytogenetics | 12p13.31 |
Refseq ORF | 537 |
Synonyms | my036; p29ING4 |
Summary | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402512 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426813 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402512 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 |
CNY 3,080.00 |
|
LY426813 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 |
CNY 3,080.00 |
|
PH302827 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) |
CNY 19,520.00 |
|
PH325191 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) |
CNY 14,250.00 |
|
TP302827 | Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg |
CNY 2,900.00 |