TMEM240 (NM_001114748) Human Recombinant Protein
CAT#: TP325178
Recombinant protein of human chromosome 1 open reading frame 70 (C1orf70), 20 µg
View other "TMEM240" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225178 representing NM_001114748
Red=Cloning site Green=Tags(s) MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001108220 |
Locus ID | 339453 |
UniProt ID | Q5SV17 |
Cytogenetics | 1p36.33 |
Refseq ORF | 519 |
Synonyms | C1orf70; SCA21 |
Summary | This gene encodes a transmembrane-domain containing protein found in the brain and cerebellum. Mutations in this gene result in spinocerebellar ataxia 21. [provided by RefSeq, Dec 2014] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The TMEM240 Protein, Mutated in SCA21, Is Expressed in Purkinje Cells and Synaptic Terminals
,Homa, M;Loyens, A;Eddarkaoui, S;Faivre, E;Deramecourt, V;Maurage, CA;Buée, L;Huin, V;Sablonnière, B;,
Cerebellum
,PubMed ID 32002801
[TMEM240]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426507 | TMEM240 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY426507 | Transient overexpression lysate of chromosome 1 open reading frame 70 (C1orf70) |
CNY 3,080.00 |
|
PH325178 | C1orf70 MS Standard C13 and N15-labeled recombinant protein (NP_001108220) |
CNY 19,520.00 |
其它TMEM240产品