CNBP (NM_001127196) Human Recombinant Protein
CAT#: TP325167
Purified recombinant protein of Homo sapiens CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 20 µg
View other "CNBP" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225167 representing NM_001127196
Red=Cloning site Green=Tags(s) MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNC GRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVA INCSKTSEVNCYRCGESGHLARECTIEATA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120668 |
Locus ID | 7555 |
UniProt ID | P62633 |
Cytogenetics | 3q21.3 |
Refseq ORF | 510 |
Synonyms | CNBP1; DM2; PROMM; RNF163; ZCCHC22; ZNF9 |
Summary | This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418710 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426696 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426700 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418710 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3 |
CN¥ 3,080.00 |
|
LY426696 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426700 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6 |
CN¥ 3,080.00 |
|
PH314473 | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_003409) |
CN¥ 19,520.00 |
|
PH325167 | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_001120668) |
CN¥ 14,250.00 |
|
TP314473 | Recombinant protein of human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 20 µg |
CN¥ 2,900.00 |