C1orf144 (SZRD1) (NM_001114600) Human Recombinant Protein
CAT#: TP325131
Purified recombinant protein of Homo sapiens chromosome 1 open reading frame 144 (C1orf144), transcript variant 1, 20 µg
View other "C1orf144" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225131 representing NM_001114600
Red=Cloning site Green=Tags(s) MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNG VVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPL GPDGSQGFKQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001108072 |
Locus ID | 26099 |
UniProt ID | Q7Z422 |
Cytogenetics | 1p36.13 |
Refseq ORF | 456 |
Synonyms | C1orf144 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414455 | SZRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414455 | Transient overexpression lysate of chromosome 1 open reading frame 144 (C1orf144), transcript variant 2 |
CNY 3,080.00 |
|
PH305077 | C1orf144 MS Standard C13 and N15-labeled recombinant protein (NP_056424) |
CNY 19,520.00 |
|
PH325131 | C1orf144 MS Standard C13 and N15-labeled recombinant protein (NP_001108072) |
CNY 14,250.00 |
|
TP305077 | Recombinant protein of human chromosome 1 open reading frame 144 (C1orf144), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它C1orf144产品