United States
Germany
Japan
United Kingdom
China
FXYD2 (NM_001127489) Human Recombinant Protein
CAT＃: TP325122
Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg
View other "FXYD2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225122 representing NM_001127489
Red=Cloning site Green=Tags(s) MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTTGCCGQAAERD SCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSKWGGLQGRGADQGTSLLKAAEQAGFRE LPREG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001120961 |
| Locus ID | 486 |
| UniProt ID | P54710 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 435 |
| Synonyms | ATP1G1; HOMG2; MGC12372 |
| Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411967 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419804 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426799 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411967 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b |
CNY 3,080.00 |
|
| LY419804 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
CNY 3,080.00 |
|
| LY426799 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c |
CNY 3,080.00 |
|
| PH302739 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) |
CNY 19,520.00 |
|
| PH305076 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) |
CNY 19,520.00 |
|
| PH325122 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) |
CNY 19,520.00 |
|
| TP302739 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP305076 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg |
CNY 2,900.00 |
