INCA (CARD17) (NM_001007232) Human Recombinant Protein
CAT#: TP324934
Recombinant protein of human caspase recruitment domain family, member 17 (CARD17), 20 µg
View other "INCA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224934 representing NM_001007232
Red=Cloning site Green=Tags(s) MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007233 |
Locus ID | 440068 |
UniProt ID | Q5XLA6 |
Refseq Size | 466 |
Cytogenetics | 11q22.3 |
Refseq ORF | 330 |
Synonyms | INCA |
Summary | Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423457 | CARD17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423457 | Transient overexpression lysate of caspase recruitment domain family, member 17 (CARD17) |
CNY 3,080.00 |
|
PH324934 | CARD17 MS Standard C13 and N15-labeled recombinant protein (NP_001007233) |
CNY 14,250.00 |