INCA (CARD17) (NM_001007232) Human Mass Spec Standard
CAT#: PH324934
CARD17 MS Standard C13 and N15-labeled recombinant protein (NP_001007233)
View other "INCA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CARD17 MS Standard C13 and N15-labeled recombinant protein (NP_001007233) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224934 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC224934 representing NM_001007232
Red=Cloning site Green=Tags(s) MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007233 |
RefSeq Size | 466 |
RefSeq ORF | 330 |
Synonyms | INCA |
Locus ID | 440068 |
Cytogenetics | 11q22.3 |
Summary | Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423457 | CARD17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423457 | Transient overexpression lysate of caspase recruitment domain family, member 17 (CARD17) |
CNY 3,080.00 |
|
TP324934 | Recombinant protein of human caspase recruitment domain family, member 17 (CARD17), 20 µg |
CNY 2,900.00 |