United States
Germany
Japan
United Kingdom
China
ROR1 (NM_001083592) Human Recombinant Protein
CAT＃: TP324765
Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, 20 µg
View other "ROR1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224765 representing NM_001083592
Red=Cloning site Green=Tags(s) MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001077061 |
| Locus ID | 4919 |
| UniProt ID | Q01973 |
| Refseq Size | 2303 |
| Cytogenetics | 1p31.3 |
| Refseq ORF | 1179 |
| Synonyms | dJ537F10.1; NTRKR1 |
| Summary | This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401558 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC421225 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401558 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1 |
CNY 4,840.00 |
|
| LY421225 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 |
CNY 3,080.00 |
|
| PH314967 | ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_005003) |
CNY 19,520.00 |
|
| PH324765 | ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_001077061) |
CNY 19,520.00 |
|
| TP314967 | Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP700158 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells. |
CNY 6,650.00 |
|
| TP700159 | Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
|
| TP700184 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells, with Fc tag |
CNY 6,650.00 |
|
| TP762391 | Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, Gln30-Tyr406, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
