BHLHE23 (NM_080606) Human Recombinant Protein
CAT#: TP324722
Recombinant protein of human basic helix-loop-helix family, member e23 (BHLHE23), 20 µg
View other "BHLHE23" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224722 representing NM_080606
Red=Cloning site Green=Tags(s) MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSG DEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSK IATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAF SGTPSALCKHCHEKP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 23.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542173 |
Locus ID | 128408 |
UniProt ID | Q8NDY6 |
Refseq Size | 942 |
Cytogenetics | 20q13.33 |
Refseq ORF | 675 |
Synonyms | bA305P22.3; Beta3b; BETA4; BHLHB4 |
Summary | This gene encodes a member of the basic helix-loop-helix transcription factor family. Members of this family contain two highly conserved and functionally distinct domains: the basic domain targets sequence-specific DNA binding, while the helix-loop-helix domain facilitates protein interaction. Studies of a related gene in mouse suggest that the encoded protein may function as a transcriptional repressor in the pancreas and brain, and that it is required for normal retinal function. [provided by RefSeq, May 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409150 | BHLHE23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409150 | Transient overexpression lysate of basic helix-loop-helix family, member e23 (BHLHE23) |
CNY 3,080.00 |
|
PH324722 | BHLHE23 MS Standard C13 and N15-labeled recombinant protein (NP_542173) |
CNY 19,520.00 |
其它BHLHE23产品