DGKG (NM_001080744) Human Recombinant Protein
CAT#: TP324710
Recombinant protein of human diacylglycerol kinase, gamma 90kDa (DGKG), transcript variant 2, 20 µg
View other "DGKG" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224710 protein sequence
Red=Cloning site Green=Tags(s) MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP LSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA ATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHI AQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK KPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL VMQYKIIPTPGTHPLLVLVNPKSGGRQGERLNFFRDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVA VLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSI GVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGI AILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKS AGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 86.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001074213 |
Locus ID | 1608 |
UniProt ID | P49619 |
Refseq Size | 5743 |
Cytogenetics | 3q27.2-q27.3 |
Refseq ORF | 2298 |
Synonyms | DAGK3; DGK-GAMMA |
Summary | This gene encodes an enzyme that is a member of the type I subfamily of diacylglycerol kinases, which are involved in lipid metabolism. These enzymes generate phosphatidic acid by catalyzing the phosphorylation of diacylglycerol, a fundamental lipid second messenger that activates numerous proteins, including protein kinase C isoforms, Ras guanyl nucleotide-releasing proteins and some transient receptor potential channels. Diacylglycerol kinase gamma has been implicated in cell cycle regulation and in the negative regulation of macrophage differentiation in leukemia cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421106 | DGKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421107 | DGKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY421106 | Transient overexpression lysate of diacylglycerol kinase, gamma 90kDa (DGKG), transcript variant 2 |
CNY 4,840.00 |
|
LY421107 | Transient overexpression lysate of diacylglycerol kinase, gamma 90kDa (DGKG), transcript variant 3 |
CNY 4,840.00 |
|
PH314133 | DGKG MS Standard C13 and N15-labeled recombinant protein (NP_001074214) |
CNY 19,520.00 |
|
PH324710 | DGKG MS Standard C13 and N15-labeled recombinant protein (NP_001074213) |
CNY 19,520.00 |
|
TP314133 | Recombinant protein of human diacylglycerol kinase, gamma 90kDa (DGKG), transcript variant 3, 20 µg |
CNY 2,900.00 |