United States
Germany
Japan
United Kingdom
China
FYN (NM_002037) Human Recombinant Protein
CAT＃: TP324691
Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg
View other "FYN" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224691 representing NM_002037
Red=Cloning site Green=Tags(s) MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | FYN activity verified in a biochemical assay: FYN (FYN oncogene related to SRC, FGR, YES) (TP324691) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. FYN is a non-receptor tyrosine kinase and is a member of the Src kinase family consisting of Src, Fyn, Yes, Lck, Lyn, Hck, Fgr and Blk. Varying concentrations of FYN were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “&DeltaR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
| Reference Data | |
| RefSeq | NP_002028 |
| Locus ID | 2534 |
| UniProt ID | P06241 |
| Refseq Size | 2650 |
| Cytogenetics | 6q21 |
| Refseq ORF | 1611 |
| Synonyms | p59-FYN; SLK; SYN |
| Summary | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Two novel ligand-independent variants of the VEGFR-1 receptor are expressed in human testis and spermatozoa, one of them with the ability to activate SRC proto-oncogene tyrosine kinases
,null,
Oncotarget
,PubMed ID 31645906
[FYN]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400745 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC403505 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407122 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400745 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 |
CNY 4,840.00 |
|
| LY403505 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 |
CNY 4,840.00 |
|
| LY407122 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 |
CNY 3,080.00 |
|
| PH307620 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593) |
CNY 19,520.00 |
|
| PH319374 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592) |
CNY 19,520.00 |
|
| PH324691 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) |
CNY 19,520.00 |
|
| TP307620 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP319374 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg |
CNY 2,900.00 |
