RAE1 (NM_003610) Human Recombinant Protein
CAT#: TP324655
Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 1, 20 µg
View other "RAE1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224655 protein sequence
Red=Cloning site Green=Tags(s) MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK NYIFLRNAAEELKPRNKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003601 |
Locus ID | 8480 |
UniProt ID | P78406 |
Refseq Size | 1815 |
Cytogenetics | 20q13.31 |
Refseq ORF | 1104 |
Synonyms | dJ481F12.3; dJ800J21.1; Gle2; MIG14; Mnrp41; MRNP41 |
Summary | Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418550 | RAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423133 | RAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418550 | Transient overexpression lysate of RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 1 |
CNY 3,080.00 |
|
LY423133 | Transient overexpression lysate of RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2 |
CNY 3,080.00 |
|
PH310733 | RAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001015885) |
CNY 19,520.00 |
|
PH324655 | RAE1 MS Standard C13 and N15-labeled recombinant protein (NP_003601) |
CNY 19,520.00 |
|
TP310733 | Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2, 20 µg |
CNY 2,900.00 |