ZNF167 (ZKSCAN7) (NM_025169) Human Recombinant Protein
CAT#: TP324628
Recombinant protein of human zinc finger protein 167 (ZNF167), transcript variant 2, 20 µg
View other "ZNF167" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224628 representing NM_025169
Red=Cloning site Green=Tags(s) MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQE ALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSE EVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQV GNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLGWSTMA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079445 |
Locus ID | 55888 |
UniProt ID | Q9P0L1 |
Refseq Size | 1792 |
Cytogenetics | 3p21.31 |
Refseq ORF | 828 |
Synonyms | ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39 |
Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410855 | ZKSCAN7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412958 | ZKSCAN7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY410855 | Transient overexpression lysate of zinc finger protein 167 (ZNF167), transcript variant 2 |
CNY 3,080.00 |
|
LY412958 | Transient overexpression lysate of zinc finger protein 167 (ZNF167), transcript variant 1 |
CNY 4,840.00 |
|
PH324628 | ZNF167 MS Standard C13 and N15-labeled recombinant protein (NP_079445) |
CNY 19,520.00 |