ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF167 antibody: synthetic peptide directed towards the N terminal of human ZNF167. Synthetic peptide located within the following region: LGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	zinc finger with KRAB and SCAN domains 7
Database Link	NP_061121 Entrez Gene 55888 Human UniProt ID Q9P0L1
Background	May be involved in transcriptional regulation.
Synonyms	ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39
Note	Immunogen Sequence Homology: Human: 100%; Rat: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.